PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_022201-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 260aa    MW: 30070.4 Da    PI: 6.7804
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_022201-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv+ v ++G ++W+ Ia   g++Rt+k+c++rw +yl
  AHYPO_022201-RA  8 KGPWTEQEDLQLVCFVGLFGDRRWDFIATVSGLKRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding55.71.1e-1761106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++l ++++ q+G++ W++Iar+++ gRt++++k++w++++
  AHYPO_022201-RA  61 RGKMTPHEEKLVLELHSQWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.511355IPR017930Myb domain
SuperFamilySSF466891.83E-286102IPR009057Homeodomain-like
SMARTSM007171.9E-14757IPR001005SANT/Myb domain
PfamPF002493.2E-15855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-19962IPR009057Homeodomain-like
CDDcd001672.13E-91055No hitNo description
PROSITE profilePS5129425.61656110IPR017930Myb domain
SMARTSM007171.9E-1660108IPR001005SANT/Myb domain
PfamPF002492.6E-1561105IPR001005SANT/Myb domain
CDDcd001671.21E-1063106No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2363109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVQEEIRKGP WTEQEDLQLV CFVGLFGDRR WDFIATVSGL KRTGKSCRLR WVNYLHPGLK  60
RGKMTPHEEK LVLELHSQWG NRWSRIARRL PGRTDNEIKN YWRTHMRKKA QEKKQETSPS  120
SSSSSSSSSS STSDSSSSWN NRAVNSKSAT ETTESFDSTI VQDMSAQQGK KYEKDEDERD  180
EFYSMDDIWK DISSDEPIKP VCDVYRERGN FNCPLLASSL WEYCPETLWR IGGDESKMFF  240
STNDQFVSCY QHEHMSLTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-2751101105MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-27111051159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-27111051159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685834.11e-137PREDICTED: transcription factor MYB59
SwissprotQ9LX821e-88MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0K9QEZ61e-121A0A0K9QEZ6_SPIOL; Uncharacterized protein
STRINGVIT_06s0004g04140.t011e-110(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.34e-84myb domain protein 59